PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012507.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 1223aa    MW: 132629 Da    PI: 7.7584
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012507.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048e-33905962260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK+vkgse+prsY++Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Aco012507.1 905 DDGYNWRKYGQKQVKGSENPRSYFKCTYPNCPTKKKVERSL-DGQITEIVYKGTHNHPK 962
                  8****************************************.***************85 PP

2WRKY104.84.6e-3310631121159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY    1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59  
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct+++Cpv+k+ver+++d ++v++tYeg+Hnh+
  Aco012507.1 1063 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPDCPVRKHVERASHDLRAVITTYEGKHNHD 1121
                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.80.10.104.0E-5139342IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520472.82E-4093342No hitNo description
SMARTSM0036776102127IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM0036751129154IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM0036724155180IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM0036775181205IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003670.33206231IPR006553Leucine-rich repeat, cysteine-containing subtype
PfamPF135160.74231254IPR001611Leucine-rich repeat
SMARTSM003678.9232256IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM0036757257281IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003678.5282307IPR006553Leucine-rich repeat, cysteine-containing subtype
SuperFamilySSF520471.83E-43317605No hitNo description
SMARTSM00367270333357IPR006553Leucine-rich repeat, cysteine-containing subtype
Gene3DG3DSA:3.80.10.101.6E-4343451IPR032675Leucine-rich repeat domain, L domain-like
PfamPF135160.05358378IPR001611Leucine-rich repeat
SMARTSM003678.3E-5358383IPR006553Leucine-rich repeat, cysteine-containing subtype
PfamPF135161.3384403IPR001611Leucine-rich repeat
SMARTSM003674.2384409IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003670.35410435IPR006553Leucine-rich repeat, cysteine-containing subtype
PfamPF135160.027436454IPR001611Leucine-rich repeat
Gene3DG3DSA:3.80.10.107.2E-35479669IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM003672.8486511IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003674.1E-5512537IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003670.0019538563IPR006553Leucine-rich repeat, cysteine-containing subtype
PfamPF135160.023562586IPR001611Leucine-rich repeat
SMARTSM003677.6564588IPR006553Leucine-rich repeat, cysteine-containing subtype
SMARTSM003670.18589614IPR006553Leucine-rich repeat, cysteine-containing subtype
PfamPF135160.038615636IPR001611Leucine-rich repeat
SMARTSM003670.83615639IPR006553Leucine-rich repeat, cysteine-containing subtype
Gene3DG3DSA:2.20.25.801.7E-28894963IPR003657WRKY domain
SuperFamilySSF1182902.75E-25898963IPR003657WRKY domain
PROSITE profilePS5081123.284899963IPR003657WRKY domain
SMARTSM007741.4E-36904962IPR003657WRKY domain
PfamPF031064.1E-25905961IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-3610481123IPR003657WRKY domain
SuperFamilySSF1182906.15E-2910551123IPR003657WRKY domain
PROSITE profilePS5081137.3910581123IPR003657WRKY domain
SMARTSM007742.5E-3810631122IPR003657WRKY domain
PfamPF031067.4E-2510641121IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1223 aa     Download sequence    Send to blast
MGEIGGAPFE TLVLDLFSKR RDRLPCPSLR SPKRIRVEEE PSPFETLAEE ILFLILDRLD  60
ANPLDRKAFS LVSRSFHAAE SRHRRALRPL RAELLPAALA RYPAVSRLDL SLCRRVGDAA  120
LGCVAAALRS TLRSIDLSRS RSFSPAGLES LAVSCAALVE IDLSNATGLT DAAAAAIGKA  180
RNLERLWLAR CMRVTDMGIG CIAVGCPKLR LLCLKWCLGV TDLGVGLVAV KCRMLQSLDL  240
SYTAITKKSL AALSQLHDLE DLAVVGCPSM SDEALSSLKQ GFKSLEVLDV SSCDRVSHVG  300
LSSILNSAPG LRQLRLAYHS FVTPSISSGL QRLSTLQSIN LDCSHVTTNG LKSIGSCCTS  360
LKELSLSKCS GVTDEGLSFI TSKNKGLVKL DITCCREITD VGIATMTSSC TSLTSLRMES  420
CSLVTSLGLR LIGQRCHLLE EVDLTDNDLD DEGIFPDITL SFVQYGIKFS CSLDHSFAGL  480
KSISGCHKLS SLKAGICLKI SDEGLVHIGN SCPELQELDL YRSVGVTDKG VTEIARGCPL  540
LQMINLAYCT EMTDESLRAL SKCSSLKTLE IRGCPRISSA GLSAIAVGCR QIAKLDIKKC  600
HDIDDAGMLP LARFSQNLRQ INLSFCSVTD VGLLALVSVS CLQNMTILHL KGVTPNGLAA  660
ALLACGGLTK VCFVSFLMVH SIFTSMASPT GSLETSANSR SMAFSFPTPS FSELLSGVGG  720
GNGGDGGVEK SGVGVPKFKS MTPTLPISPP PISPSSYFAI PSGLSPADLL DSPALLTSSI  780
FPSPTTGALF PTQSFNWRGS KDEQQSMYSD FSFQNLTKRG NMPTSYPFHS SSSAAISSEQ  840
PWNYQEPNTN TNTNTINIKS ETTHPFAPNP STLRENTNNS IGGYNSNNHA RVQPIQSIRE  900
QRRSDDGYNW RKYGQKQVKG SENPRSYFKC TYPNCPTKKK VERSLDGQIT EIVYKGTHNH  960
PKPQSTRRTS SACAVQQAHV AVANEASEHS FGGAATPENS SASFGNEEVE MSSQDAGDDE  1020
FDEDEPHAKR KREGDSEGIS MSGNRTVREP RVVVQTMSDI DILDDGYRWR KYGQKVVKGN  1080
PNPRSYYKCT TPDCPVRKHV ERASHDLRAV ITTYEGKHNH DIPAARGSSG SHAINRPQTD  1140
NNTAVAIRPS ASTGILNHPN QMMAPTNSLL NESYFYQGSY DFSGFGNKMN SYTYQQTQQQ  1200
QQQQQQQQRE SRDESFLDAL LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-368951124878Probable WRKY transcription factor 4
2lex_A3e-368951124878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026547.10.0RNI-like superfamily protein
SwissprotQ8RWU50.0FBL3_ARATH; F-box/LRR-repeat protein 3
TrEMBLA0A061EXQ10.0A0A061EXQ1_THECC; RNI-like superfamily protein
STRINGGSMUA_Achr10P29380_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP431722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-100WRKY DNA-binding protein 33